PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G050800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 404aa    MW: 44573.4 Da    PI: 7.8676
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G050800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.52.9e-41170247178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +CqvegC++ l +ak+yhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Manes.05G050800.1.p 170 RCQVEGCQVALVNAKDYHRRHKVCEMHSKAPKVIVLGLEQRFCQQCSRFHVISEFDDSKRSCRRRLAGHNERRRKSAH 247
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.8E-34165232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-38169250IPR004333Transcription factor, SBP-box
PfamPF031104.0E-32171244IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MENGGNLYTA HNNRSRGQNS ANANLVWDMW ETNSSRIDWG NSSNGTAFFT SAIASATTSA  60
AETICSTHPG AASAQALLFP HQSLYHQHDH HYQQFSLYGG EGSHFHPDPH LMCLKLGKRH  120
YFEDNIPVGD RHLGFSVGKR GKPYYSVVGG HAGPSSSAVG GVGSAANVAR CQVEGCQVAL  180
VNAKDYHRRH KVCEMHSKAP KVIVLGLEQR FCQQCSRFHV ISEFDDSKRS CRRRLAGHNE  240
RRRKSAHDSV SRNSCQDKLM AGSFPYLASP ADRALSLLSS KADSWVNSSD LSSRSSAALR  300
ELIAENRAAI LARQLFHERH LQHNAMEDLG DHSQSSFIPH HNQILADANN WERFHDTGTQ  360
LTLDLMQAPT SAFGFLSARG KNSKEEEEEC SELWNTWAGA HVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-30161244184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083645.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ7XT423e-56SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A067K9660.0A0A067K966_JATCU; Uncharacterized protein
STRINGPOPTR_0014s05690.11e-168(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-35squamosa promoter binding protein-like 3